General Information

  • ID:  hor006655
  • Uniprot ID:  Q21506
  • Protein name:  Probable insulin-like peptide alpha-type 3
  • Gene name:  ins-23
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSELHVRRVCGTAIIKNIMRLCPGVPACENGEVPSPTEYCSMGYSDSQVKYLCCPTSQ
  • Length:  58(19-76)
  • Propeptide:  MFVLLIILSIILAQVTDAHSELHVRRVCGTAIIKNIMRLCPGVPACENGEVPSPTEYCSMGYSDSQVKYLCCPTSQ
  • Signal peptide:  MFVLLIILSIILAQVTDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-40; 22-53; 28-54
  • Structure ID:  AF-Q21506-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006655_AF2.pdbhor006655_ESM.pdb

Physical Information

Mass: 737720 Formula: C269H431N77O85S8
Absent amino acids: FW Common amino acids: CSPV
pI: 7.21 Basic residues: 7
Polar residues: 24 Hydrophobic residues: 13
Hydrophobicity: -19.48 Boman Index: -8455
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 68.79
Instability Index: 6757.93 Extinction Coefficient cystines: 4845
Absorbance 280nm: 85

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.